PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A01G1608
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MIKC_MADS
Protein Properties Length: 252aa    MW: 29338.3 Da    PI: 9.2092
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A01G1608genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.91.5e-29959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 krien+snrqvt+skRrngi+KKA+E+ +LCda+v++iif+s+gk++ey+s
  Gh_A01G1608  9 KRIENSSNRQVTYSKRRNGIMKKAKEITILCDAKVSLIIFGSSGKMHEYCS 59
                 79***********************************************96 PP

2K-box61.24e-21107168970
        K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKn 70 
                  +++  + +l++e++++kke++n+q e+Rhl+Ged++sL +keL+ +e++Le++l+ +R k++
  Gh_A01G1608 107 VHDGSSRNLSNEIDRIKKENDNMQIELRHLKGEDITSLPYKELMAIEDALENGLTYVRGKQD 168
                  56667889**************************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.24161IPR002100Transcription factor, MADS-box
SMARTSM004321.9E-40160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-35290IPR002100Transcription factor, MADS-box
CDDcd002651.29E-41280No hitNo description
PRINTSPR004042.4E-28323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.7E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-283859IPR002100Transcription factor, MADS-box
PfamPF014864.5E-15111202IPR002487Transcription factor, K-box
PROSITE profilePS5129712.125112213IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MGRGKIEIKR IENSSNRQVT YSKRRNGIMK KAKEITILCD AKVSLIIFGS SGKMHEYCSP  60
STNLVDILDQ YQKTSGKKLW DAKHEAISFK AQNNNGCNRS QCKIYLVHDG SSRNLSNEID  120
RIKKENDNMQ IELRHLKGED ITSLPYKELM AIEDALENGL TYVRGKQDIK AYQSLFSFSF  180
VQMDVLDKTW KNTKFLEEDY KQLSFILNQQ QMAYESAREQ MDHGYQRARD YNSQMSSTFQ  240
VQPMQPNLQE RM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D8e-17271168Myocyte-specific enhancer factor 2A
3mu6_C8e-17271168Myocyte-specific enhancer factor 2A
3mu6_B8e-17271168Myocyte-specific enhancer factor 2A
3mu6_A8e-17271168Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.239621e-110boll
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC1556451e-140KC155645.1 Gossypium hirsutum MADS box protein MADS50 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012467961.11e-145PREDICTED: floral homeotic protein PMADS 2-like
SwissprotQ074742e-93MADS2_PETHY; Floral homeotic protein PMADS 2
TrEMBLA0A0D2NRJ20.0A0A0D2NRJ2_G
STRINGPOPTR_0002s07920.16e-99(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53002751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.12e-81MIKC_MADS family protein